Gene Rv0033 (acpP)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Key component in de novo fatty acid biosynthesis. This protein is supposed to be the carrier of the growing fatty acid chain in fatty acid biosynthesis. |
| Product | Probable acyl carrier protein AcpA (ACP) |
| Comments | Rv0033, (MTCY10H4.33), len: 87 aa. Probable acpA (alternate gene name: acpP), acyl carrier protein, similar to others. Also similar to proteins of Mycobacterium tuberculosis Rv1344 and Rv2244 (31.5% identity in 73 aa overlap). |
| Functional category | Lipid metabolism |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 36607 | 36870 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0033|acpA
MKEAINATIQRILRTDRGITANQVLVDDLGFDSLKLFQLITELEDEFDIAISFRDAQNIKTVGDVYTSVAVWFPETAKPAPLGKGTA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Huang Y, Ge J, Yao Y, Wang Q, Shen H and Wang H [2006]. Characterization and site-directed mutagenesis of the putative novel acyl carrier protein Rv0033 and Rv1344 from Mycobacterium tuberculosis. Biochemistry Function
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
