Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductProbable conserved transmembrane protein
CommentsRv0128, (MTCI5.02), len: 259 aa. Probable conserved transmembrane protein, with some similarity to Rv3064c and other bacterial proteins e.g. AAK85977.1|AE007957|AGR_C_254p from Agrobacterium tumefaciens (206 aa).
Functional categoryCell wall and cell processes
ProteomicsIdentified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and up-regulated after 4h, 24h and 96h of starvation (see Betts et al., 2002).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS155667156446+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0128|Rv0128
VQREIYDGEARLSWVLAALAGILGATAFTHSAGYFVTFMTGNSQRAVLGLFGDDAWMSVTASLLILFFVAGVVIASVCRRHFWAAHPHGPTVLTTFSLIFAAGVDIMLGGWHESMLDFVPILFVVFGIGALNTSFVKDGEVSVPLSYVTGTLVKMGQGIERHLAGGKVEDWLGYFLLHASFVLGAAAGGAISMVVTGPQMLAVAAVVCAATTGYTYLHADRRGLVNQKRPQPGKRLFRALRRGELDSGTSTPATNYGSS