Gene Rv0134
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in detoxification reactions following oxidative damage to lipids [catalytic activity: an epoxide + H(2)O = a glycol]. |
| Product | Possible epoxide hydrolase EphF (epoxide hydratase) (arene-oxide hydratase) |
| Comments | Rv0134, (MTCI5.08), len: 300 aa. Possible ephE, epoxide hydrolase (see citation below), similar to others e.g. Q39856 epoxide hydrolase (341 aa), FASTA scores: opt: 369, E(): 4.6e-17, (27.2% identity in 335 aa overlap); etc. Also similar to MTCY09F9.26c from Mycobacterium tuberculosis (29.5% identity in 346 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 161771 | 162673 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0134|ephF
MIALPALEGVEHRHVDVAEGVRIHVADAGPADGPAVMLVHGFPQNWWEWRDLIGPLAADGNRVLCPDLRGAGWSSAPRSRYTKTEMADDLAAVLDGLGVAKVKLVAHDWGGPVAFIMMLRHPEKVTGFFGVNTVAPWVKRDLGMLRNMWRFWYQIPMSLPVIGPRVISDPKGRYFRLLTGWVGGGFRVPDDDVRLYLDCMREPGHAEAGSRWYRTFQTREMLRWLRGEYNDARVDVPVRWLHGTGDPVITPDLLDGYAERASDFEVELVDGVGHWIVEQRPELVLDRVRAFLAAGTEQRD
Bibliography
- Tekaia F et al. [1999]. Analysis of the proteome of Mycobacterium tuberculosis in silico. Secondary Function
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
