Gene Rv0149
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Possibly binds NADP and acts through a one-electron transfer process. Quinones are supposed to be the best substrates. May act in the detoxification of xenobiotics [catalytic activity: NADPH + quinone = NADP+ + semiquinone] |
| Product | Possible quinone oxidoreductase (NADPH:quinone oxidoreductase) (zeta-crystallin) |
| Comments | Rv0149, (MTCI5.23), len: 322 aa. Possible quinone oxidoreductase, similar to others oxidoreductases e.g. Q08257 quinone oxidoreductase (329 aa), FASTA scores: opt: 397, E(): 3.2e-18, (28.4% identity in 328 aa overlap); SCHCOADH_4 from Streptomyces coelicolor. Also similar to many proteins from Mycobacterium tuberculosis. Contains PS01162 Quinone oxidoreductase / zeta-crystallin signature. Belongs to the zinc-containing alcohol dehydrogenase family, quinone oxidoreductase subfamily. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 175700 | 176668 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0149|Rv0149
MKACVVKELSGPSGMVYTDIDEVSGDGGKVVIDVRAAGVCFPDLLLTKGEYQLKLTPPFVPGMETAGVVRSAPSDAGFHVGERVSAFGVLGGYAEQIAVPVANVVRSPVELDDAGAVSLLVNYNTMYFALARRAALRPGDTVLVLGAAGGVGTAAVQIAKAMQAGKVIAMVHREGAIDYVASLGADVVLPLTEGWAQQVRDHTYGQGVDIVVDPIGGPTFDDALGVLAIDGKLLLIGFAAGAVPTLKVNRLLVRNISVVGVGWGEYLNAVPGSAALFAWGLNQLVFLGLRPPPPQRYPLSEAQAALQSLDDGGVLGKVVLEP
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
