Gene Mb0154
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible quinone oxidoreductase (nadph:quinone oxidoreductase) (zeta-crystallin) |
| Comments | Mb0154, -, len: 322 aa. Equivalent to Rv0149, len: 322 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 322 aa overlap). Putative quinone oxidoreductase (EC 1.6.5.-), similar to others oxidoreductases e.g. Q08257 quinone oxidoreductase (EC 1.6.5.5) (329 aa), FASTA scores: opt: 397, E(): 3.2e-18,(28.4% identity in 328 aa overlap); SCHCOADH_4 from Streptomyces coelicolor. Also similar to many proteins from Mycobacterium tuberculosis. Contains PS01162 Quinone oxidoreductase / zeta-crystallin signature. BELONG TO THE ZINC-CONTAINING ALCOHOL DEHYDROGENASE FAMILY, QUINONE OXIDOREDUCTASE SUBFAMILY. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 175890 | 176858 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0154|Mb0154
MKACVVKELSGPSGMVYTDIDEVSGDGGKVVIDVRAAGVCFPDLLLTKGEYQLKLTPPFVPGMETAGVVRSAPSDAGFHVGERVSAFGVLGGYAEQIAVPVANVVRSPVELDDAGAVSLLVNYNTMYFALARRAALRPGDTVLVLGAAGGVGTAAVQIAKAMQAGKVIAMVHREGAIDYVASLGADVVLPLTEGWAQQVRDHTYGQGVDIVVDPIGGPTFDDALGVLAIDGKLLLIGFAAGAVPTLKVNRLLVRNISVVGVGWGEYLNAVPGSAALFAWGLNQLVFLGLRPPPPQRYPLSEAQAALQSLDDGGVLGKVVLEP
Bibliography
No article yet recorded
