Gene Rv0157A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved protein |
| Comments | Rv0157A, len: 42 aa. Conserved protein, showing similarity to C-terminal part (aa 186-220) of O53976|Rv1975|MTV051.13 conserved hypothetical protein from Mycobacterium tuberculosis (221 aa), FASTA scores: opt: 173, E(): 3e-06, (62.5% identity in 40 aa overlap). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the culture filtrate, membrane fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 186495 | 186623 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0157A|Rv0157A
VMDPSPDYDVSDEIEFFFRYLTWGLRGVETGDGYPPPAYPPV
Bibliography
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant