Gene Mb0162A 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | Conserved protein | 
| Comments | Mb0162A, len: 42 aa. Equivalent to Rv0157A len: 42 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 42 aa overlap). Transferred from H37Rv annotation using Rapid Annotation Transfer Tool (Nucleic Acids Res. 2011 May; 39(9): e57). Conserved protein,showing similarity to C-terminal part (aa 186-220) of O53976|Rv1975|MTV051.13 conserved hypothetical protein from Mycobacterium tuberculosis (221 aa), FASTA scores: opt: 173, E(): 3e-06, (62.5% identity in 40 aa overlap). | 
| Functional category | Conserved hypotheticals | 
| Mutant | Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 186685 | 186813 | - | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb0162A|Mb0162A
MMDPSPDYDVSDEIEFFFRYLTWGLRGVETGDGYPPPAYPPV
      
    Bibliography
    No article yet recorded