Gene Mb0162A
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved protein |
| Comments | Mb0162A, len: 42 aa. Equivalent to Rv0157A len: 42 aa, from Mycobacterium tuberculosis strain H37Rv, (100.0% identity in 42 aa overlap). Transferred from H37Rv annotation using Rapid Annotation Transfer Tool (Nucleic Acids Res. 2011 May; 39(9): e57). Conserved protein,showing similarity to C-terminal part (aa 186-220) of O53976|Rv1975|MTV051.13 conserved hypothetical protein from Mycobacterium tuberculosis (221 aa), FASTA scores: opt: 173, E(): 3e-06, (62.5% identity in 40 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 186685 | 186813 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0162A|Mb0162A
MMDPSPDYDVSDEIEFFFRYLTWGLRGVETGDGYPPPAYPPV
Bibliography
No article yet recorded