Gene Rv0192A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved secreted protein |
| Comments | Rv0192A, len: 100 aa. Probable N-terminal part of Rv0192, which is member of family P5.17 with Rv0116c, Rv1433, Rv2518c, Rv0483. These are all predicted to be exported/membrane proteins. Rv0192A has typical N-terminal signal peptide which is functional and was identified by PhoA fusion screens: O52054 PGB14T-O1 precursor (fragment 45 AA) (see Chubb et al., 1998). Since Rv0192 misses a signal peptide this suggests that there is a frameshift in the region of the overlap with Rv0192 but none found on reinspection of sequence. |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 223607 | 223909 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0192A|Rv0192A
MSRWKQGWTRGSLFAALNIAAVVAVLMLGAGVAVADPDAAPGDPGGPGAPGAQRDPSTRRQLTCWRRHPTRWRCRRHLTRWRRRHLTRSRRPRLTRWQCR
Bibliography
- Chubb AJ, Woodman ZL, da Silva Tatley FM, Hoffmann HJ, Scholle RR and Ehlers MR [1998]. Identification of Mycobacterium tuberculosis signal sequences that direct the export of a leaderless beta-lactamase gene product in Escherichia coli. Sequence Localization
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
