Gene Mb0198
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved secreted protein |
| Comments | Mb0198, -, len: 352 aa. Equivalent to Rv0192 and Rv0192A, len: 366 aa and 100 aa, from Mycobacterium tuberculosis strain H37Rv, (96.5% identity in 318 aa overlap and 91.1% identity in 56 aa overlap). Conserved hypothetical protein. Has Gly- Arg-rich region followed by highly Pro-rich repetitive region near N-terminus. Similar in C-terminus to other hypothetical proteins e.g. Q49706|B1496_F2_81|U00013 from Mycobacterium leprae (271 aa), FASTA scores: opt: 375, E(): 3.2e-24, (36.1% identity in 255 aa overlap); YV09_MYCTU|Q11149|cY20G9.09 hypothetical 47.9 kd protein from Mycobacterium tuberculosis (451 aa), FASTA scores: opt: 330, E(): 3.2e-13, (35.1% identity in 271 aa overlap). Also similar to Rv0116c, Rv1433, Rv2518c, Rv0483 from Mycobacterium tuberculosis. Probable N-terminal part of Rv0192, which is member of family P5.17 with Rv0116c, Rv1433, Rv2518c,Rv0483. These are all predicted to be exported/membrane proteins. Rv0192A has typical N-terminal signal peptide which is functional and was identified by PhoA fusion screens: O52054 PGB14T-O1 PRECURSOR (FRAGMENT 45 AA) (see citation below). Since Rv0192 misses a signal peptide this suggests that there is a frameshift in the region of the overlap with Rv0192 but none found on reinspection of sequence. REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis strain H37Rv, Rv0192 and Rv0192A exist as 2 genes with an overlap region. In Mycobacterium bovis, a single base insertion (*-g) leads to a single product. |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 223799 | 224857 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0198|Mb0198
MSRWKQGWTRGSLFAALNIAAVVAVLMLGAGVAVADPDAAPGDPGGPGGPGGTAGPVDPPAVDLLAPPPDPLALPPALDPLAPPPPDPLAPPPPDPLAVPVAAGPVAGQDPTPFVGPPPFRPPTFNPVDGAMVGVAKPIVINFAVPIADRAMAESAIHISSIPPVPGKFYWMSPTQVRWRPFEFWPANTAVNIDAAGTKSSFRTGDSLVATADDATHQMTITRNGVVQKTFPMSMGMVSGGHQTPNGTYYVLEKFATVVMDSSTYGVPVNSAQGYKLTVSDAVRIDNSGNFVHSAPWSVADQGKRNVTHGCINLSPANAKWFYDNFGSGDPVVVKNSVGTYNKNDGAQDWQI
Bibliography
No article yet recorded
