Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible conserved transmembrane protein
CommentsRv0200, (MTV033.08), len: 229 aa. Possible conserved transmembrane protein, equivalent to Z95398|MLCL622.14 from Mycobacterium leprae (229 aa), FASTA scores: opt: 1147, E(): 0, (74.7% identity in 229 aa overlap). Also some similarity to Rv1973 from Mycobacterium tuberculosis (160 aa); and Rv1362c|Z75555|MTCY02B10_26 (220 aa), FASTA scores: opt: 134, E(): 0.063, (25.8% identity in 159 aa overlap). A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004).
Functional categoryCell wall and cell processes
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS; predicted transmembrane protein (See Gu et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS237206237895+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0200|Rv0200
MRNAWRLVVFDVLAPLATIAALAAIGVLLGWPLWWVSTCSVLVLLVVEGVAINFWLLRRDSVTVGTDDDAPGLRLAVVFLCAAAISAAVVTGYLRWTTPDRDFNRDSREVVHLATGMAETVASFSPSAPAAAVDRAAAMMVPEHAGGFKEQYAKSSADLARRGVTAQAATLAAGVEAIGPSAASVAVILRVSQSIPGQPTSQAARALRVTLTKRGSGWLVLDVTPINAR