Gene Rv0221
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | May be involved in synthesis of triacylglycerol |
| Product | Possible triacylglycerol synthase (diacylglycerol acyltransferase) |
| Comments | Rv0221, (MTCY08D5.16), len: 469 aa. Possible triacylglycerol synthase (See Daniel et al., 2004), similar to other proteins from Mycobacterium tuberculosis e.g. Q50680|Rv2285|MT2343|MTCY339.25c 47.7 kDa protein (445 aa), FASTA scores: opt: 455, E(): 8.1e-23, (26.7% identity in 461 aa overlap); Rv3740c, Rv3734c, etc. |
| Functional category | Lipid metabolism |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 264067 | 265476 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0221|Rv0221
VKRLSGWDAVLLYSETPNVHMHTLKVAVIELDSDRQEFGVDAFREVIAGRLHKLEPLGYQLVDVPLKFHHPMWREHCQVDLNYHIRPWRLRAPGGRRELDEAVGEIASTPLNRDHPLWEMYFVEGLANHRIAVVAKIHHALADGVASANMMARGMDLLPGPEVGRYVPDPAPTKRQLLSAAFIDHLRHLGRIPATIRYTTQGLGRVRRSSRKLSPALTMPFTPPPTFMNHRLTPERRFATATLALIDVKATAKLLGATINDMVLAMSTGALRTLLLRYDGKAEPLLASVPVSYDFSPERISGNRFTGMLVALPADSDDPLQRVRVCHENAVSAKESHQLLGPELISRWAAYWPPAGAEALFRWLSERDGQNKVLNLNISNVPGPRERGRVGAALVTEIYSVGPLTAGSGLNITVWSYVDQLNISVLTDGSTVQDPHEVTAGMIADFIEIRRAAGLSVELTVVESAMAQA
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Daniel J, Deb C, Dubey VS, Sirakova TD, Abomoelak B, Morbidoni HR and Kolattukudy PE [2004]. Induction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture. Function Product
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
