Gene Mb0227
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible triacylglycerol synthase (diacylglycerol acyltransferase) |
| Comments | Mb0227, -, len: 257 aa. Equivalent to 5' end of Rv0221, len: 469 aa, from Mycobacterium tuberculosis strain H37Rv, (98.3% identity in 234 aa overlap). Conserved hypothetical protein, similar to others proteins from Mycobacterium tuberculosis e.g. Q50680|Rv2285|MT2343|MTCY339.25c hypothetical 47.7 kDa protein (445 aa), FASTA scores: opt: 455, E(): 8.1e-23,(26.7% identity in 461 aa overlap); Rv3740c, Rv3734c, etc. REMARK-M.bovis-M.tuberculosis: In Mycobacterium bovis, a 1902 bp deletion leads to a shorter product with a different COOH part, compared to its homolog in Mycobacterium tuberculosis strain H37Rv (257 aa versus 469 aa). It also leads to the deletion of the next protein,echA1 (Rv0222). |
| Functional category | |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 264292 | 265065 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0227|Mb0227
MKRLSGWDAVLLYSETPNVHMHTLKVAVIELDSDRQEFGVDAFREVIAGRLHKLEPLGYQLVDVPLKFHHPMWREHCQVDLNYHIRPWRLRAPGGRRELDEAVGEIASTPLNRDHPLWEMYFVEGLANHRIAVVAKIHHALADGVASANMMARGMDLLPGPEVGRYVPDPAPTKRQLLSAAFIDHLRHLGRIPATIRYTTQGLGRVRRSSRKLSPALTMPFTPPPTFMNRIKKPLSKPSGRPPPHTNRAPSSMPLAM
Bibliography
No article yet recorded
