Gene Rv0232
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in transcriptional mechanism. |
| Product | Probable transcriptional regulatory protein (probably TetR/AcrR-family) |
| Comments | Rv0232, (MTCY08D5.28), len: 229 aa. Probable transcriptional regulatory protein, TetR/AcrR family, similar to others e.g. YIXD_BACSU|P32398 hypothetical transcriptional regulator (191 aa), FASTA scores: opt: 149, E(): 0.0014, (21.5% identity in 158 aa overlap). Also similar to MTV030_11 from Mycobacterium tuberculosis. Contains PS01081 Bacterial regulatory proteins, TetR family signature, and probable helix-turn helix motif from aa 33-54 (Score 1142, +3.08 SD). Belongs to the TetR/AcrR family of transcriptional regulators. |
| Functional category | Regulatory proteins |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 277899 | 278588 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0232|Rv0232
MPTVTWARVDPARRAAVVEAAEAEFGAHGFSRGSLNVIARRAGVAKGSLFQYFADKRDLYAFIADIASQRVRSYMEDLIRELDPNRPFFEFLTDLLDGWVAYFAEHPRERALHAAATLEVDTDARISVRSVLHRHYLDVLRPLVRDAHARGDLRADSDTGALMSLLLLIFPHLALAPYMRGLDPILGLDEPTPEQPALAVRRLVAVLAAAFDAQHPATNSAQTRSEEIT
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Maciag A et al. [2007]. Global analysis of the Mycobacterium tuberculosis Zur (FurB) regulon. Regulon
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
