Gene Rv0239
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible antitoxin VapB24 |
| Comments | Rv0239, (MTV034.05), len: 77 aa. Possible vapB24, antitoxin, part of toxin-antitoxin (TA) operon with Rv0240. Weakly similar to others e.g. Rv1839c|Z83859|MTCY359_34 from Mycobacterium tuberculosis (87 aa). See Arcus et al. 2005. FASTA scores: opt: 88, E(): 5, (40.0% identity in 45 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 289104 | 289337 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0239|vapB24
MIRTQVQLPDELYRDAKRVAHEHEMTLAEVVRRGLEHMVRIYPRRDAASDTWQPPTPRRLGPFRASEETWRELANEA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Arcus VL et al. [2005]. The PIN-domain toxin-antitoxin array in mycobacteria. Biochemistry
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant