Gene Mb0245
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | possible antitoxin vapb24 |
| Comments | Mb0245, -, len: 77 aa. Equivalent to Rv0239, len: 77 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 77 aa overlap). Conserved hypothetical protein, weakly similar to Rv1839c|Z83859|MTCY359_34 from Mycobacterium tuberculosis (87 aa), FASTA scores: opt: 88,E(): 5, (40.0% identity in 45 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 287428 | 287661 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0245|vapb24
MIRTQVQLPDELYRDAKRVAHEHEMTLAEVVRRGLEHMVRIYPRRDAASDTWQPPTPRRLGPFRASEETWRELANEA
Bibliography
No article yet recorded