Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThought to be involved in the initiation step of translation at high temperature. Bound to 30S ribosomal subunit. Possibly a molecular chaperone. Seems to be regulated positively by SIGE|Rv1221 and negatively by HSPR|Rv0353.
ProductHeat shock protein Hsp (heat-stress-induced ribosome-binding protein A)
CommentsRv0251c, (MTV034.17c), len: 159 aa. Hsp (alternate gene name: hsp20, hrpA, acr2), heat-stress-induced ribosome-binding protein A (see citations below). Highly similar to AAD39038.1|AF072875_1|AF072875 putative HSP20 from Mycobacterium smegmatis (145 aa), FASTA scores: opt: 479, E(): 2.3e-24, (59.9% identity in 157 aa overlap); and similar to many bacterial and eukaryotic hsp proteins e.g. P12811|HS2C_CHLRE chloroplast heat shock 22KD protein from chlamydomonas reinhardtii (157 aa), FASTA scores: opt: 184, E(): 1.2e-05, (32.4% identity in 142 aa overlap). Also similar to PCC6803 Spore protein sp21 from Synechocystis sp. (146 aa), FASTA scores: opt: 213, E(): 1.2e-07, (30.3 identity in 145 aa overlap). Also similar to P30223|14KD_MYCTU 14 KDA antigen (16 KDA antigen) 19K major membrane protein (HSP 16.3) from Mycobacterium tuberculosis (144 aa). Belongs to the small heat shock protein (HSP20) family.
Functional category-
ProteomicsIdentified in Triton X-114 and carbonate extracts of M. tuberculosis H37Rv membranes using 2DGE and MALDI-MS (See Sinha et al., 2002). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the aqueous phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using 2-DGE and MALDI-TOF-MS (See Sinha et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
TranscriptomicsmRNA identified by DNA microarray analysis: highly up-regulated at high temperatures, and possibly down-regulated by hrcA|Rv2374c (see Stewart et al., 2002). Also up-regulated after 24h and 96h of starvation (see Betts et al., 2002). DNA microarrays and qRT-PCR show lower level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006). qRT-PCR shows lower expression under control conditions and SDS stress but higher under heat shock, in mprAB mutant than in H37Rv (See Pang and Howard, 2007).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS302173302652-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0251c|hsp
MNNLALWSRPVWDVEPWDRWLRDFFGPAATTDWYRPVAGDFTPAAEIVKDGDDAVVRLELPGIDVDKDVNVELDPGQPVSRLVIRGEHRDEHTQDAGDKDGRTLREIRYGSFRRSFRLPAHVTSEAIAASYDAGVLTVRVAGAYKAPAETQAQRIAITK
      
Bibliography