Gene Rv0251c (hsp20, hrpA, acr2)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in the initiation step of translation at high temperature. Bound to 30S ribosomal subunit. Possibly a molecular chaperone. Seems to be regulated positively by SIGE|Rv1221 and negatively by HSPR|Rv0353. |
| Product | Heat shock protein Hsp (heat-stress-induced ribosome-binding protein A) |
| Comments | Rv0251c, (MTV034.17c), len: 159 aa. Hsp (alternate gene name: hsp20, hrpA, acr2), heat-stress-induced ribosome-binding protein A (see citations below). Highly similar to AAD39038.1|AF072875_1|AF072875 putative HSP20 from Mycobacterium smegmatis (145 aa), FASTA scores: opt: 479, E(): 2.3e-24, (59.9% identity in 157 aa overlap); and similar to many bacterial and eukaryotic hsp proteins e.g. P12811|HS2C_CHLRE chloroplast heat shock 22KD protein from chlamydomonas reinhardtii (157 aa), FASTA scores: opt: 184, E(): 1.2e-05, (32.4% identity in 142 aa overlap). Also similar to PCC6803 Spore protein sp21 from Synechocystis sp. (146 aa), FASTA scores: opt: 213, E(): 1.2e-07, (30.3 identity in 145 aa overlap). Also similar to P30223|14KD_MYCTU 14 KDA antigen (16 KDA antigen) 19K major membrane protein (HSP 16.3) from Mycobacterium tuberculosis (144 aa). Belongs to the small heat shock protein (HSP20) family. |
| Functional category | - |
| Proteomics | Identified in Triton X-114 and carbonate extracts of M. tuberculosis H37Rv membranes using 2DGE and MALDI-MS (See Sinha et al., 2002). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the aqueous phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using 2-DGE and MALDI-TOF-MS (See Sinha et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). |
| Transcriptomics | mRNA identified by DNA microarray analysis: highly up-regulated at high temperatures, and possibly down-regulated by hrcA|Rv2374c (see Stewart et al., 2002). Also up-regulated after 24h and 96h of starvation (see Betts et al., 2002). DNA microarrays and qRT-PCR show lower level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006). qRT-PCR shows lower expression under control conditions and SDS stress but higher under heat shock, in mprAB mutant than in H37Rv (See Pang and Howard, 2007). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 302173 | 302652 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0251c|hsp
MNNLALWSRPVWDVEPWDRWLRDFFGPAATTDWYRPVAGDFTPAAEIVKDGDDAVVRLELPGIDVDKDVNVELDPGQPVSRLVIRGEHRDEHTQDAGDKDGRTLREIRYGSFRRSFRLPAHVTSEAIAASYDAGVLTVRVAGAYKAPAETQAQRIAITK
Bibliography
- Ohara N et al. [1997]. HrpA, a new ribosome-associated protein which appears in heat-stressed Mycobacterium bovis bacillus Calmette-Guérin. Homolog Product Function
- Tabira Y, Ohara N and Yamada T [2000]. Identification and characterization of the ribosome-associated protein, HrpA, of Bacillus Calmette-Guérin. Homolog Product Function
- Manganelli R et al. [2001]. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Regulation
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Mutant Regulation
- Sinha S et al. [2002]. Proteome analysis of the plasma membrane of Mycobacterium tuberculosis. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sinha S, Kosalai K, Arora S, Namane A, Sharma P, Gaikwad AN, Brodin P and Cole ST [2005]. Immunogenic membrane-associated proteins of Mycobacterium tuberculosis revealed by proteomics. Proteomics
- Walters SB et al. [2006]. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Transcriptome
- Pang X and Howard ST [2007]. Regulation of the alpha-crystallin gene acr2 by the MprAB two-component system of Mycobacterium tuberculosis. Regulation Transcriptome
- Lee JH et al. [2008]. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. Regulon
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant