Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in nitrate assimilation (denitrification); required for activity of the reductase [catalytic activity: 3 NAD(P)H + nitrite = 3 NAD(P)+ + NH4OH + H2O.]
ProductProbable nitrite reductase [NAD(P)H] small subunit NirD
CommentsRv0253, (MTV034.19), len: 118 aa. Probable nirD, nitrite reductase [NAD(P)H] small subunit, similar to others e.g. P23675|NIRD_ECOLI|B3366|Z4727|ECS4217 from Escherichia coli strains K12 and O157:H7 (108 aa), FASTA scores: opt: 271, E():1.7e-12, (41.9% identity in 105 aa overlap). Associates with NIRB|Rv0252.
Functional categoryIntermediary metabolism and respiration
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS305453305809+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0253|nirD
VTLLNDIQVWTTACAYDHLIPGRGVGVLLDDGSQVALFRLDDGSVHAVGNVDPFSGAAVMSRGIVGDRGGRAMVQSPILKQAFALDDGSCLDDPRVSVPVYPARVTPEGRIQVARVAV