Gene Rv0258c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv0258c, (MTCY06A4.02c), len: 151 aa (alternative start possible). Conserved hypothetical protein, showing some similarity to Rv1685c|MTCI125_6 from Mycobacterium tuberculosis (207 aa), FASTA scores: E(): 9.3e-07, (32.1% identity in 140 aa overlap). Also some similarity with AL049819|SCE7_13|T36295 probable transcription regulator from Streptomyces coelicolor (204 aa), FASTA scores: opt: 158, E(): 0.00052, (27.0% identity in 111 aa overlap). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 310294 | 310749 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0258c|Rv0258c
MARSQEPSRGLLDPVAKMLRLPFGTPDFIEKIVTGSVNQVGRRTLYVLITTWDAAGGGPFAASAIATTGLAKTAEIVQSMFIGPVFNPLLKMLGADKIAIRASLCAAQLVGLGIMRYGVRSEPLHSMSVEMLVDAIGPTMQRYLVGDIGRG
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
