Gene Rv0263c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv0263c, (MTCY06A4.07c), len: 300 aa. Conserved hypothetical protein, equivalent to NP_302634.1|NC_002677 conserved hypothetical protein from Mycobacterium leprae (305 aa). Also similar to others e.g. AL121596|SC51A_21 hypothetical protein from Streptomyces coelicolor (285 aa), FASTA scores: opt: 714, E(): 0, (45.3% identity in 289 aa overlap); NP_233164.1|NC_002506 conserved hypothetical protein from Vibrio cholerae (309 aa); NP_406216.1|NC_003143 conserved hypothetical protein from Yersinia pestis (316 aa); YH30_HAEIN|P44298|hi1730 hypothetical protein from Haemophilus influenzae (309 aa), FASTA scores: opt: 430, E(): 3e-20, (29.6% identity in 284 aa overlap); etc. Also similar to carboxylases eg NP_415240.1|NC_000913|P75745|YBGK_ECOLI putative carboxylase from Escherichia coli strain K12 (310 aa), FASTA score: (34.6% identity in 286 aa overlap); NP_459698.1|NC_003197 putative carboxylase from Salmonella typhimurium (310 aa); and to middle part of NP_420636.1|NC_002696 urea amidolyase-related protein from Caulobacter crescentus (1207 aa). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | DNA microarrays show lower level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 314864 | 315766 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0263c|Rv0263c
MTTLEILRSGPLALVEDLGRAGLAHLGVGRSGAADRRSHTLANRLVANPDDWATVEVTFGGFSARVRGGDVDIAVTGADTDPTVNGIMVGTNSIHHVRDGQVISLGTPRAGLRTYLAVRGGVCVEPVLGSRSYDVMSAIGPSPLRAGDVLPVGEHTDDYPELDQAPVAAIEEHLVELRVVPGPRDDWLVDPDALVHTIWMASNRSDRVGMRLQGRPLQHRWPDRQLPGEGVTRGAIQVPPNGLPVILGPDHPITGSYPVVGVITDEDIDKVAQIRPGQYVRLHWARPRSRLPGQGVTQAW
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Walters SB et al. [2006]. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Transcriptome
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
