Gene Mb0269c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | CONSERVED HYPOTHETICAL PROTEIN |
| Comments | Mb0269c, -, len: 300 aa. Equivalent to Rv0263c,len: 300 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 300 aa overlap). Conserved hypothetical protein, equivalent to NP_302634.1|NC_002677 conserved hypothetical protein from Mycobacterium leprae (305 aa). Also similar to others e.g. AL121596|SC51A_21 hypothetical protein from Streptomyces coelicolor (285 aa), FASTA scores: opt: 714, E(): 0, (45.3% identity in 289 aa overlap); NP_233164.1|NC_002506 conserved hypothetical protein from Vibrio cholerae (309 aa); NP_406216.1|NC_003143 conserved hypothetical protein from Yersinia pestis (316 aa); YH30_HAEIN|P44298|hi1730 hypothetical protein from Haemophilus influenzae (309 aa),FASTA scores: opt: 430, E(): 3e-20, (29.6% identity in 284 aa overlap); etc. Also similar to carboxylases eg NP_415240.1|NC_000913|P75745|YBGK_ECOLI putative carboxylase from Escherichia coli strain K12 (310 aa),FASTA score: (34.6% identity in 286 aa overlap); NP_459698.1|NC_003197 putative carboxylase from Salmonella typhimurium (310 aa); and to middle part of NP_420636.1|NC_002696 urea amidolyase-related protein from Caulobacter crescentus (1207 aa). |
| Functional category | Conserved hypotheticals |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 313189 | 314091 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0269c|Mb0269c
MTTLEILRSGPLALVEDLGRAGLAHLGVGRSGAADRRSHTLANRLVANPDDWATVEVTFGGFSARVRGGDVDIAVTGADTDPTVNGIMVGTNSIHHVRDGQVISLGTPRAGLRTYLAVRGGVCVEPVLGSRSYDVMSAIGPSPLRAGDVLPVGEHTDDYPELDQAPVAAIEEHLVELRVVPGPRDDWLVDPDALVHTIWMASNRSDRVGMRLQGRPLQHRWPDRQLPGEGVTRGAIQVPPNGLPVILGPDHPITGSYPVVGVITDEDIDKVAQIRPGQYVRLHWARPRSRLPGQGVTQAW
Bibliography
No article yet recorded
