Gene Rv0273c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Could be involved in transcriptional mechanism. |
| Product | Possible transcriptional regulatory protein |
| Comments | Rv0273c, (MTV035.01c), len: 206 aa (start uncertain). Possible transcriptional regulator, showing some similarity to hypothetical regulators from Mycobacterium tuberculosis e.g. P96222|Rv3855|MTCY01A6.13c (216 aa); O08377|Rv1534|MTCY07A7A.03 (225 aa), FASTA scores: opt: 123, E(): 3.2e-06, (28.5% identity in 172 aa overlap). |
| Functional category | Regulatory proteins |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). M. smegmatis transposon mutant (inserted at Rv0273c-Rv0272c) is sensitve to oxidative stress from diamide, iodoacetamide and chlorodinitrobenzene; complemented by M. tuberculosis H37Rv Rv0274 (See Rawat et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 329705 | 330325 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0273c|Rv0273c
VPDFPTQRGRRTQAAIDAAARTVVVRNGILATTVADITAEAGRSAASFYNYYDSKEAMVRQWALRFRDDANQRALSVIRHGLSDRERAYEAAAAHWYTYRNRLAEAISVSQLAMVSDDFAQYWSEICQIPISFITETVKRAQAHGYCVGDDPQLMAEAIVAMFNQFCYLQLSGKRSRRGQPDDQACIQTLANIYYRAIYSKEDSSN
Bibliography
- Rawat M, Heys J and Av-Gay Y [2003]. Identification and characterization of a diamide sensitive mutant of Mycobacterium smegmatis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
