Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionCould be involved in transcriptional mechanism.
ProductPossible transcriptional regulatory protein
CommentsRv0273c, (MTV035.01c), len: 206 aa (start uncertain). Possible transcriptional regulator, showing some similarity to hypothetical regulators from Mycobacterium tuberculosis e.g. P96222|Rv3855|MTCY01A6.13c (216 aa); O08377|Rv1534|MTCY07A7A.03 (225 aa), FASTA scores: opt: 123, E(): 3.2e-06, (28.5% identity in 172 aa overlap).
Functional categoryRegulatory proteins
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). M. smegmatis transposon mutant (inserted at Rv0273c-Rv0272c) is sensitve to oxidative stress from diamide, iodoacetamide and chlorodinitrobenzene; complemented by M. tuberculosis H37Rv Rv0274 (See Rawat et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS329705330325-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0273c|Rv0273c
VPDFPTQRGRRTQAAIDAAARTVVVRNGILATTVADITAEAGRSAASFYNYYDSKEAMVRQWALRFRDDANQRALSVIRHGLSDRERAYEAAAAHWYTYRNRLAEAISVSQLAMVSDDFAQYWSEICQIPISFITETVKRAQAHGYCVGDDPQLMAEAIVAMFNQFCYLQLSGKRSRRGQPDDQACIQTLANIYYRAIYSKEDSSN