Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved protein
CommentsRv0274, (MTV035.02), len: 193 aa. Conserved protein, highly similar to AAK25058.1|AE005973 conserved hypothetical protein from Caulobacter crescentus (174 aa). Shows also some similarity to others hypothetical proteins e.g. AJ002571|BSAJ2571_7 from Bacillus subtilis (316 aa), FASTA scores: opt: 138, E(): 0.033, (27.1% identity in 133 aa overlap). Previous hits with Q56415|M85195 fosfomycin-resistance protein from serratia marcescens (141 aa), FASTA scores: opt: 82, E(): 1.1e -08, (29.1% identity in 151 aa overlap). Contains PS00082 Extradiol ring-cleavage dioxygenases signature near C-terminus. May belong to the vicinal-oxygen-chelate (VOC) superfamily of metalloenzymes (See Rawat et al., 2003).
Functional categoryConserved hypotheticals
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate and membrane protein fraction of M. tuberculosis H37Rv but not whole cell lysates (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and up-regulated after 4h, 24h and 96h of starvation (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). M. smegmatis transposon mutant (inserted at Rv0273c-Rv0272c) is sensitve to oxidative stress from diamide, iodoacetamide and chlorodinitrobenzene; complemented by M. tuberculosis H37Rv Rv0274 (See Rawat et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS330422331003+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0274|Rv0274
MIKPHNTNTEFELGGINHVALVCSDMARTVDFYSNILGMPLIKALDLPGGQGQHFFFDAGNGDCVAFFWFADAPDRVPGLSSPVAIPGIGDITSAVSTMNHLAFHVPAERFDAYRQRLKDKGVRVGPVLNHDDSETQVSAVVHPGVYVRSFYFQDPDGITLEFACWTKEFTTSDAQAVPKTAADRRPPVAADR