Gene Rv0277A
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible antitoxin VapB25 |
| Comments | Rv0277A, len: 85 aa. Possible vapB25, antitoxin, part of toxin-antitoxin (TA) operon with Rv0277c, see Arcus et al. 2005. Has in-frame stop codon so may not be expressed. Very similar to others in Mycobacterium tuberculosis e.g. Rv0748 (85 aa). Fasta score E(): 4e-24; 88.2% identity in 85 aa overlap |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 333160 | 333417 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0277A|vapB25
MRTTVSISDELLATAKRRARERGSLGAVIEDALRRELAAARTGGARPTVPVFDAGTGPRPGIDLTSNTVLSEVLDEGLELNSRK
Bibliography
- Arcus VL et al. [2005]. The PIN-domain toxin-antitoxin array in mycobacteria. Biochemistry
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function