Gene Rv0287 (TB9.8)
in Mycobacterium tuberculosis H37Rv
General annotation
      | Type | CDS | 
| Function | Function unknown | 
| Product | ESAT-6 like protein EsxG (conserved protein TB9.8) | 
| Comments | Rv0287, (MTV035.15), len: 97 aa. EsxG, ESAT-6 like protein. PE-family related protein; distant member of the Mycobacterium tuberculosis PE family, similar to Rv3020c|AL0212|MTV012.34 (97 aa), FASTA scores: opt: 564, E(): 0, (91.8% identity in 97 aa overlap). Contains probable helix-turn-helix motif at aa 14-35 (Score 144, +4.11 SD). Seems to belong to the ESAT6 family (see Gey Van Pittius et al., 2001). Note that previously known as TB9.8. | 
| Functional category | Cell wall and cell processes | 
| Proteomics | The product of this CDS corresponds to spot 0287 (or TB9.8) identified in short term culture filtrate by proteomics at the Statens Serum Institute (Denmark) (See Rosenkrands et al., 2000a, 2000b). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). Identified in the culture filtrate of M. tuberculosis H37Rv using LC-MS/MS; antigen recognized by serum pool from tuberculosis patients (See Malen et al., 2008). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011). | 
| Transcriptomics | mRNA identified by microarray analysis and down-regulated after 24h of starvation (see Betts et al., 2002). DNA microarrays indicate repression by iron and IdeR|Rv2711 in M. tuberculosis H37Rv (See Rodriguez et al., 2002). | 
| Operon | Rv0287 and Rv0288 are co-transcribed, by RT-PCR (see Roback et al., 2007). | 
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 351525 | 351818 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium tuberculosis H37Rv|Rv0287|esxG
MSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGF
      
    Bibliography
    - Rosenkrands I et al. [2000]. Towards the proteome of Mycobacterium tuberculosis. Proteomics
- Rosenkrands I, Weldingh K, Jacobsen S, Hansen CV, Florio W, Gianetri I and Andersen P [2000]. Mapping and identification of Mycobacterium tuberculosis proteins by two-dimensional gel electrophoresis, microsequencing and immunodetection. Proteomics
- Gey Van Pittius NC, Gamieldien J, Hide W, Brown GD, Siezen RJ and Beyers AD [2001]. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Secondary Phylogeny
- Rodriguez GM, Voskuil MI, Gold B, Schoolnik GK and Smith I [2002]. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Transcriptome
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Mattow J, Schaible UE, Schmidt F, Hagens K, Siejak F, Brestrich G, Haeselbarth G, Muller EC, Jungblut PR and Kaufmann SH [2003]. Comparative proteome analysis of culture supernatant proteins from virulent Mycobacterium tuberculosis H37Rv and attenuated M. bovis BCG Copenhagen. Proteomics
- Sun R, Converse PJ, Ko C, Tyagi S, Morrison NE and Bishai WR [2004]. Mycobacterium tuberculosis ECF sigma factor sigC is required for lethality in mice and for the conditional expression of a defined gene set. Regulon
- Roback P et al. [2007]. A predicted operon map for Mycobacterium tuberculosis. Operon
- Målen H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- Maciag A et al. [2007]. Global analysis of the Mycobacterium tuberculosis Zur (FurB) regulon. Regulon
- Malen H, Softeland T and Wiker HG [2008]. Antigen analysis of Mycobacterium tuberculosis H37Rv culture filtrate proteins. Proteomics
- Lightbody KL, Ilghari D, Waters LC, Carey G, Bailey MA, Williamson RA, Renshaw PS and Carr MD [2008]. Molecular features governing the stability and specificity of functional complex formation by Mycobacterium tuberculosis CFP-10/ESAT-6 family proteins. Biophysics Structure
- [2009]. Systematic genetic nomenclature for type VII secretion systems. Nomenclature
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- de Souza GA et al. [2011]. Proteogenomic analysis of polymorphisms and gene annotation divergences in prokaryotes using a clustered mass spectrometry-friendly database. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant