Gene Mb0295
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | esat-6 like protein esxg (conserved protein tb9.8) |
Comments | Mb0295, esxG, len: 97 aa. Equivalent to Rv0287,len: 97 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 97 aa overlap). esxG, conserved hypothetical protein. PE-family related protein; distant member of the Mycobacterium tuberculosis PE family,similar to Rv3020c|AL0212|MTV012.34 (97 aa), FASTA scores: opt: 564, E(): 0, (91.8% identity in 97 aa overlap). Contains probable helix-turn-helix motif at aa 14-35 (Score 144, +4.11 SD). SEEMS TO BELONG TO THE ESAT6 FAMILY (see third citation below). |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 352527 | 352820 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0295|esxG MSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGF
Bibliography
No article yet recorded