Gene Mb0295 
in Mycobacterium bovis AF2122/97
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | esat-6 like protein esxg (conserved protein tb9.8) | 
| Comments | Mb0295, esxG, len: 97 aa. Equivalent to Rv0287,len: 97 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 97 aa overlap). esxG, conserved hypothetical protein. PE-family related protein; distant member of the Mycobacterium tuberculosis PE family,similar to Rv3020c|AL0212|MTV012.34 (97 aa), FASTA scores: opt: 564, E(): 0, (91.8% identity in 97 aa overlap). Contains probable helix-turn-helix motif at aa 14-35 (Score 144, +4.11 SD). SEEMS TO BELONG TO THE ESAT6 FAMILY (see third citation below). | 
| Functional category | Cell wall and cell processes | 
| Mutant | Check for mutants available at TARGET website  | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 352527 | 352820 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium bovis AF2122-97|Mb0295|esxG
MSLLDAHIPQLVASQSAFAAKAGLMRHTIGQAEQAAMSAQAFHQGESSAAFQAAHARFVAAAAKVNTLLDVAQANLGEAAGTYVAADAAAASTYTGF
      
    Bibliography
    No article yet recorded