Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown. May be involved in virulence.
ProductLow molecular weight protein antigen 7 EsxH (10 kDa antigen) (CFP-7) (protein TB10.4)
CommentsRv0288, (MT0301, MTV035.16), len: 96 aa. EsxH, low molecular weight protein antigen 7 (10 kDa antigen) (CFP-7) (Protein TB10.4) (see citations below), ala-rich protein; member of mycobacterial protein family containing ESAT-6, very similar to MTV012_33 from Mycobacterium tuberculosis (96 aa), FASTA scores: opt: 566, E(): 0, (84.4% identity in 96 aa overlap). Alternative start codon possible position 351878 (see Rosenkrands et al., 2000). Belongs to the ESAT6 family (see Skjot et al., 2000; 2002; Gey Van Pittius et al., 2001). Note that previously known as cfp7 (alternate gene name: TB10.4). A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). Predicted possible vaccine candidate (See Zvi et al., 2008).
Functional categoryCell wall and cell processes
ProteomicsThe product of this CDS corresponds to spots 0288 identified in short term culture filtrate by proteomics at the Statens Serum Institute (Denmark) (See Rosenkrands et al., 2000a, 2000b; Skjot et al., 2000).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 24h of starvation (see Betts et al., 2002). DNA microarrays indicate repression by iron and IdeR|Rv2711 in M. tuberculosis H37Rv (See Rodriguez et al., 2002).
OperonRv0287 and Rv0288 are co-transcribed, by RT-PCR (see Roback et al., 2007).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS351848352138+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0288|esxH
MSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG
      
Bibliography