Gene Mb0296
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | low molecular weight protein antigen 7 esxh (10 kda antigen) (cfp-7) (protein tb10.4) |
Comments | Mb0296, esxH, len: 96 aa. Equivalent to Rv0288,len: 96 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 96 aa overlap). esxH (alternate gene name: TB10.4), low molecular weight protein antigen 7 (10 kDa antigen) (CFP-7) (Protein TB10.4) (see citations below), ala-rich protein; member of mycobacterial protein family containing ESAT-6, very similar to MTV012_33 from Mycobacterium tuberculosis (96 aa), FASTA scores: opt: 566, E(): 0, (84.4% identity in 96 aa overlap). Alternative start codon possible position 351878 (see second citation). BELONG TO THE ESAT6 FAMILY (see first,sixth and seventh citations below). |
Functional category | Cell wall and cell processes |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 352850 | 353140 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0296|esxH MSQIMYNYPAMLGHAGDMAGYAGTLQSLGAEIAVEQAALQSAWQGDTGITYQAWQAQWNQAMEDLVRAYHAMSSTHEANTMAMMARDTAEAAKWGG
Bibliography
No article yet recorded