Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in interconversion of dCTP and dUTP [catalytic activity: dCTP + H2O = dUTP + NH3].
ProductProbable deoxycytidine triphosphate deaminase Dcd (dCTP deaminase)
CommentsRv0321, (MTCY63.26), len: 190 aa. Probable dcd (alternate gene names: dus or paxA), deoxycytidine triphosphate deaminase, equivalent to CAC32024.1|AL583925 probable deoxycytidine triphosphate deaminase from Mycobacterium leprae (190 aa). Also highly similar to others e.g. Q9X8W0|DCD_STRCO|7480599|T36613|SCH35.46 deoxycytidine triphosphate deaminase from Streptomyces coelicolor (191 aa); DCD_ECOLI|P28248|DUS|PAXA|B2065 deoxycytidine triphosphate deaminase from Escherichia coli strain K12 (193 aa), FASTA scores: opt: 408, E(): 2.7e-21, (43.1% identity in 188 aa overlap); etc. Contains PS00017 ATP/GTP-binding site motif A (P-loop). Belongs to the dCTP deaminase family. The transcription of this CDS seems to be activated specifically in host granulomas (see citation below).
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS388582389154+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0321|dcd
VLLSDRDLRAEISSGRLGIDPFDDTLVQPSSIDVRLDCLFRVFNNTRYTHIDPAKQQDELTSLVQPVDGEPFVLHPGEFVLGSTLELFTLPDNLAGRLEGKSSLGRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGMKIGQLCMLRLTSPSEHPYGSSRAGSKYQGQRGPTPSRSYQNFIRST