Gene Rv0321 (dus, paxA)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in interconversion of dCTP and dUTP [catalytic activity: dCTP + H2O = dUTP + NH3]. |
| Product | Probable deoxycytidine triphosphate deaminase Dcd (dCTP deaminase) |
| Comments | Rv0321, (MTCY63.26), len: 190 aa. Probable dcd (alternate gene names: dus or paxA), deoxycytidine triphosphate deaminase, equivalent to CAC32024.1|AL583925 probable deoxycytidine triphosphate deaminase from Mycobacterium leprae (190 aa). Also highly similar to others e.g. Q9X8W0|DCD_STRCO|7480599|T36613|SCH35.46 deoxycytidine triphosphate deaminase from Streptomyces coelicolor (191 aa); DCD_ECOLI|P28248|DUS|PAXA|B2065 deoxycytidine triphosphate deaminase from Escherichia coli strain K12 (193 aa), FASTA scores: opt: 408, E(): 2.7e-21, (43.1% identity in 188 aa overlap); etc. Contains PS00017 ATP/GTP-binding site motif A (P-loop). Belongs to the dCTP deaminase family. The transcription of this CDS seems to be activated specifically in host granulomas (see citation below). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 388582 | 389154 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0321|dcd
VLLSDRDLRAEISSGRLGIDPFDDTLVQPSSIDVRLDCLFRVFNNTRYTHIDPAKQQDELTSLVQPVDGEPFVLHPGEFVLGSTLELFTLPDNLAGRLEGKSSLGRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGMKIGQLCMLRLTSPSEHPYGSSRAGSKYQGQRGPTPSRSYQNFIRST
Bibliography
- Ramakrishnan L et al. [2000]. Granuloma-specific expression of Mycobacterium virulence proteins from the glycine-rich PE-PGRS family. Homolog Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Helt SS, Thymark M, Harris P, Aagaard C, Dietrich J, Larsen S and Willemoes M [2008]. Mechanism of dTTP inhibition of the bifunctional dCTP deaminase:dUTPase encoded by Mycobacterium tuberculosis. Structure
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant