Gene Rv0328
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Possibly involved in a transcriptional mechanism. |
| Product | Possible transcriptional regulatory protein (possibly TetR/AcrR-family) |
| Comments | Rv0328, (MTCY63.33), len: 200 aa. Possible transcription regulator, TetR/acrR family, similar in part to various hypothetical transcriptional regulators e.g. T36696|4726006|CAB41735.1|AL049731 probable regulatory protein from Streptomyces coelicolor (197 aa). Also some similarity with YX44_MYCTU|Q10829 hypothetical transcriptional regulator from Mycobacterium tuberculosis (195 aa), FASTA scores: opt: 154, E(): 0.00061, (26.7% identity in 202 aa overlap). Contains probable helix-turn helix motif from aa 27-48 (Score 1408, +3.98 SD). Seems to belong to the TetR/AcrR family of transcriptional regulators. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Regulatory proteins |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 394111 | 394713 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0328|Rv0328
VQQQRTNRDKLLDGALACLRERGYGNTSSRDIARAAGVNIASINYHFGSKDALLDDALGRCFSTWNQRVQEAFDHSRAAGPAGQILAVLEATVDSFEQIRPAVYACVESYAPALRSEALRERLAAGYADVRQHSVDLAGAALAGTDIAPPENLSTIVSVLMAVIDGLMIQWIADPSATPRSTEVIRALASIGAVVTSQLR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant