Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionPossibly involved in a transcriptional mechanism.
ProductPossible transcriptional regulatory protein (possibly TetR/AcrR-family)
CommentsRv0328, (MTCY63.33), len: 200 aa. Possible transcription regulator, TetR/acrR family, similar in part to various hypothetical transcriptional regulators e.g. T36696|4726006|CAB41735.1|AL049731 probable regulatory protein from Streptomyces coelicolor (197 aa). Also some similarity with YX44_MYCTU|Q10829 hypothetical transcriptional regulator from Mycobacterium tuberculosis (195 aa), FASTA scores: opt: 154, E(): 0.00061, (26.7% identity in 202 aa overlap). Contains probable helix-turn helix motif from aa 27-48 (Score 1408, +3.98 SD). Seems to belong to the TetR/AcrR family of transcriptional regulators. This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryRegulatory proteins
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS394111394713+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0328|Rv0328
VQQQRTNRDKLLDGALACLRERGYGNTSSRDIARAAGVNIASINYHFGSKDALLDDALGRCFSTWNQRVQEAFDHSRAAGPAGQILAVLEATVDSFEQIRPAVYACVESYAPALRSEALRERLAAGYADVRQHSVDLAGAALAGTDIAPPENLSTIVSVLMAVIDGLMIQWIADPSATPRSTEVIRALASIGAVVTSQLR