Gene Rv0347 
in Mycobacterium tuberculosis H37Rv
General annotation
      | Type | CDS | 
| Function | Unknown | 
| Product | Probable conserved membrane protein | 
| Comments | Rv0347, (MTCY13E10.07), len: 328 aa (alternative start possible). Probable conserved membrane protein, similar to Rv0831c|AL022004|MTV043_23 from Mycobacterium tuberculosis (271 aa), FASTA scores: E(): 9.6e-21, (33.1% identity in 266 aa overlap). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). | 
| Functional category | Cell wall and cell processes | 
| Proteomics | Identified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). | 
| Transcriptomics | mRNA identified by DNA microarray analysis and up-regulated at high temperatures (see citation below). | 
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene results in growth defect of H37Rv in vitro, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website | 
Coordinates
    | Type | Start | End | Orientation | 
|---|---|---|---|
| CDS | 417304 | 418290 | + | 
       Genomic sequence
    
     
         Feature type 
	 Upstream flanking region (bp) 
	 Downstream flanking region (bp) 
	 
         Update
       
       
       
     Protein sequence
    >Mycobacterium tuberculosis H37Rv|Rv0347|Rv0347
VPGARELTLRVERGALFRRRWAASAASSARAAIRRDPRRCALGTRPRWVSFLVIVLVIMNVVTAHPKYPNDPLALVLIELRHPRTEPPVPSAISILKEELARWTPILEQEEVRQVNLETGEHTAHSQKKLVARDRRTAITFRPDAMTLEVTDYPGWEEFRSIVHAMVTARQDVAPVDGCIRIGLRYINEIRASLAEPSGWAYWVAESLLGPGTQLADLKLTTTAQRHVIQCEGPEPGDSLTLRYAGARGAVIQSTPFLQRLKEPPAEGDFFLIDIDSAWSDPCKGIPALDAHLVDEVAERLHTPIGPLFESLITSELRTKVLQQPGQE
      
    Bibliography
    - Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Mutant Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Rodrigue S et al. [2007]. Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. Regulon
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant