Gene Rv0359
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved integral membrane protein |
| Comments | Rv0359, (MTCY13E10.21), len: 259 aa. Probable conserved integral membrane protein, highly similar to hypothetical or other membrane proteins e.g. AL133220|SCC75A_6|T50569 probable membrane protein from Streptomyces coelicolor (265 aa), FASTA scores: opt: 642, E(): 0, (43.1% identity in 248 aa overlap); P70995 hypothetical 24.7 kDa protein from Bacillus subtilis (219 aa), FASTA scores: E(): 1.5e-12, (31.3% identity in 192 aa overlap). Contains neutral zinc metallopeptidases, zinc-binding region signature (PS00142). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 437518 | 438297 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0359|Rv0359
VSETGQRESVRPSPIFLGLLGLTAVGGALAWLAGETVQPLAYAGVFVMVIAGWLVSLCLHEFGHAFTAWRFGDHDVAVRGYLTLDPRRYSHPMLSLGLPMLFIALGGIGLPGAAVYVHTWFMTTARRTLVSLAGPTVNLALAMLLLAATRLLFDPIHAVLWAGVAFLAFLQLTALVLNLLPIPGLDGYAALEPHLRPETQRALAPAKQFALVFLLVLFLAPTLNGWFFGVVYWLFDLSGVSHRLAAAGSVLARFWSIWF
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
