Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv0366c, (MTV036.01c), len: 197 aa. Conserved hypothetical protein, showing weak similarity to HI1395|P44173|YD95_HAEIN hypothetical protein from Haemophilus influenzae (140 aa), FASTA scores: opt: 152, E(): 0.0015, (27.0% identity in 126 aa overlap). Contains PS00017 ATP/GTP-binding site motif A (P-loop) and PS00850 Glycine radical signature.
Functional categoryConserved hypotheticals
ProteomicsIdentified in the cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS444222444815-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0366c|Rv0366c
VKRLDLVAGPNGAGKSTFVALTLAPLLPGIVFVNADEIAKQRWPDDPTSHAYQAAQVAADTRARLIDLGRPFIAETVFSHPSKLELIRTARTAGYTVVLHVLVIPEGLAVERVRHRVAAGGHDVPETKIRERHRRLAELVAQAITLADGATVYDNSRLAGPRIVAQFSGGGIIGRACWPSWTPPPLMSRWSNRPETA