Gene Rv0379
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in protein transport (export). |
| Product | Possible protein transport protein SecE2 |
| Comments | Rv0379, (MTV036.14), len: 71 aa. Possible secE2, protein transport protein, showing similarity with P27340|S61G_SULSO|SECE preprotein translocase SECE subunit (protein transport protein SEC61 gamma subunit homolog) from Sulfolobus acidocaldarius (65 aa), FASTA scores: opt: 79, E(): 4.7. (30.3% identity in 66 aa overlap); and hypothetical proteins e.g. Q9HPW4|VNG1446H hypothetical protein from Halobacterium sp. strain NRC-1 (77 aa); Q9I794|PA0038 hypothetical protein from Pseudomonas aeruginosa (71 aa); etc. Also highly similar to U85467|MTU85467_1 hypothetical Mycobacterium tuberculosis protein from a patient isolate (116 aa), FASTA scores: opt: 443, E(): 7.7e-29, (98.6% identity in 71 aa overlap). Note that for Rv0379|MTV036.14, a translation initiation region different to the one in U85467|MTU85467_1 was chosen. Could be a part of the prokaryotic protein translocation apparatus which comprise SECA|Rv3240c, SECD|Rv2587c, SECE|Rv0638, SECF|Rv2586c, SECG|Rv1440 and SECY|Rv0732. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 455977 | 456192 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0379|secE2
MSVYKVIDIIGTSPTSWEQAAAEAVQRARDSVDDIRVARVIEQDMAVDSAGKITYRIKLEVSFKMRPAQPR
Bibliography
- Mattow J, Schaible UE, Schmidt F, Hagens K, Siejak F, Brestrich G, Haeselbarth G, Muller EC, Jungblut PR and Kaufmann SH [2003]. Comparative proteome analysis of culture supernatant proteins from virulent Mycobacterium tuberculosis H37Rv and attenuated M. bovis BCG Copenhagen. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
