Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in pyrimidine biosynthesis (at the fifth step) [catalytic activity: orotidine 5'-phosphate + diphosphate = orotate + 5-phospho-alpha-D-ribose 1-diphosphate].
ProductProbable orotate phosphoribosyltransferase PyrE (OPRT) (oprtase)
CommentsRv0382c, (MTV036.17c), len: 179 aa. Probable pyrE, orotate phosphoribosyltransferase, equivalent to CAC32004.1|AL583925 probable purine/pyrimidine phosphoribosyltransferase from Mycobacterium leprae (179 aa). Also highly similar to many others e.g. T36540|4753874|CAB42037.1|AL049754|SCH10.28c probable orotate phosphoribosyltransferase from Streptomyces coelicolor (182 aa); H69115|2622996|AAB86326.1|AE000938_10|MTH1860 probable orotate phosphoribosyltransferase from Methanobacterium thermoautotrophicum (180 aa), FASTA scores: opt: 389, E(): 2.7e-20, (40.7% identity in 172 aa overlap); O08359|PYRE_SULAC|2065444|CAA73352.1|Y12822 orotate phosphoribosyltransferase from Sulfolobus acidocaldarius (197 aa); etc. Note that also similar to other puridine 5'-monophosphate synthases (umpA genes; UMP synthases), generally in N-terminus that corresponds to orotate phosphoribosyltransferase activity. Contains PS00589 PTS HPR component serine phosphorylation site signature. Belongs to the purine/pyrimidine phosphoribosyltransferase family. Note that previously known as umpA. Nucleotide position 458282 in the genome sequence has been corrected, A:G resulting in Y33Y.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS457841458380-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0382c|pyrE
VAGPDRAELAELVRRLSVVHGRVTLSSGREADYYVDLRRATLHHRASALIGRLMRELTADWDYSVVGGLTLGADPVATAIMHAPGRPIDAFVVRKSAKAHGMQRLIEGSEVTGQRVLVVEDTSTTGNSALTAVHAVQDVGGEVVGVATVVDRATGAAEAIEAEGLRYRSVLGLADLGLD
      
Bibliography