Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductPPE family protein PPE9
CommentsRv0388c, (MTV036.23c), len: 180 aa. PPE9, Member of the Mycobacterium tuberculosis PPE family, highly similar to others e.g. MTCY10G2_10|Z92539 from Mycobacterium tuberculosis (391 aa), FASTA scores: opt: 667, E(): 0, (58.3% identity in 180 aa overlap) but much shorter.
Functional categoryPe/ppe
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS467459468001-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0388c|PPE9
MDFGALPPEINSARIYSGPGSRPLMQAAAAWQRLANELTATAASYSSVISGLTGDDWLGPSALSMAAAAVPYVAWMRATAASAEQAAAQAVAAANAYESAYAATVPPTVIAANRRTMLSLVQTNVFGQNTPAIATSETHYGEMWAHDILAMDGYAGASGAASQLRRSPATGDHQRGRVAE
      
Bibliography