Gene Mb0394c
in Mycobacterium bovis AF2122/97
General annotation
| Type | CDS |
| Function | Unknown |
| Product | conserved hypothetical protein |
| Comments | Mb0394c, PPE9, len: 443 aa. Equivalent to Rv0388c and Rv0387c, len: 180 aa and 244 aa, from Mycobacterium tuberculosis strain H37Rv, (95.1% identity in 164 aa overlap and 100.0% identity in 244 aa overlap). Rv0388c: Member of the Mycobacterium tuberculosis PPE family,highly similar to others e.g. MTCY10G2_10|Z92539 from Mycobacterium tuberculosis (391 aa), FASTA scores: opt: 667, E(): 0, (58.3% identity in 180 aa overlap) but much shorter. Rv0387c: conserved hypothetical protein, showing some similarity to MTCI237.20c, and M17282|HUMEL20_1 Human elastin gene, exon 1, Elastin (687 aa), FASTA scores: opt: 193, E(): 0.35, (34.4% identity in 189 aa overlap). REMARK-M.bovis-M.tuberculosis: In Mycobacterium tuberculosis strain H37Rv, Rv0388c and Rv0387c exist as 2 separate genes. In Mycobacterium bovis, 3 different base substitutions, the first of 14 bases, the second of 8 bases (tctacagt-gctacagg), and lastly of 28 bases, leads to a longer single product. |
| Functional category | Pe/ppe |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 467689 | 469020 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0394c|PPE9
MDFGALPPEINSARIYSGPGSRPLMQAAAAWQRLANELTATAASYSSVISGLTGDDWLGPSALSMAAAAVPYVAWMRATAASAEQAAAQAVAAANAYESAYAATVPPTVIAANRRTMLSLVKTNVFGQNTPAIATSEAQYGAMWAQDIVAMEGYAGASAAASQLPPFTPPPATTSGAGSLSDAAATAAQAVVPAAAATDVSLLPTLQSFLPPPFDAIPNPIEDLDVLVAAAVAVAAGSLGVSAAQLGEIYRHDVVDEAQKAPHCPAESDQTPAGAAGDGDLPEVGGRVTSPPQPPVAALTGYSANIGGLSVPHSWNLPPAVRQVAAMFPGATPMYMTGSSDGSYAGLAAAGLAGTGLAGLAARGGSAPTPAAAAPAGAGGAGPAATRPAAQQTPAVPAAAAGSAIPGLPPGLPPGVVANLAATLAAIPGATIIVVPPSPNANQ
Bibliography
No article yet recorded
