Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible conserved lipoprotein LpqK
CommentsRv0399c, (MTCY04D9.11c), len: 409 aa. Possible lpqK, conserved lipoprotein, showing some similarity to penicillin binding proteins and various peptidases e.g. DAC_STRSQ|P15555 d-alanyl-d-alanine carboxypeptidase protein (406 aa), FASTA scores: opt: 348, E(): 5.6e-16, (29.2% identity in 301 aa overlap). Also similar to other Mycobacterium tuberculosis PBPs and esterases. Has possible N-terminal signal sequence and appropriately positioned prokaryotic lipoprotein lipid attachment site (PS00013).
Functional categoryCell wall and cell processes
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS477327478556-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0399c|lpqK
MPVLRRLGCSVLALGLLAGCAPPRTGPASSPTNNGAKADAVIRIVRDFMTQAHLKAVLVRVTVAGKEVVTRAVGDSMTGVPATTAMHFRNGAVAISYVATLLLKLVDEKKLRLDDKLSRWLPDFPHADRVTLGQLAQMTSGYPDYVLGNEAFDAELYANPFRQWTTQELLDQISSRPLLYDPGTNWNYAHTNYLLLGLALEKAAGQDMPTLLQRKVLSPLGLTATANSDTPAIPEPALHAFTSERRAALKIPAGVPFYEESTFWNPSWTITHGAIQTTTIYDMEATAVGIGSGRLLSADSYKKMVSTELRGKTRAQPGCPTCFEQNDGYSYGLGIVISGHWLLQNPMFAGYAAVEAYLPSQRVAVAVAVTYAPEAFDDQGNYRNQADILFRKIGAEVAPNDAPPMPPGR