Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductProbable conserved membrane protein MmpS1
CommentsRv0403c, (MTCY04D9.16c), len: 142 aa. Probable mmpS1, conserved membrane protein (see citation below), highly similar to other Mycobacterial proteins e.g. YV33_MYCLE|P54880 hypothetical 16.9 kDa protein from Mycobacterium leprae (154 aa), FASTA scores: opt: 458, E(): 1.6e-26, (46.9% identity in 143 aa overlap); YV33_MYCTU|Q11170 hypothetical 15.9 kDa protein from Mycobacterium tuberculosis (147 aa), FASTA scores: opt: 362, E(): 1.1e-19, (42.1% identity in 140 aa overlap); etc. Also similar to other MmpS proteins from Mycobacterium tuberculosis e.g. Rv0677c, Rv0451c, etc. Belongs to the MmpS family. Predicted to be an outer membrane protein (See Song et al., 2008).
Functional categoryCell wall and cell processes
ProteomicsIdentified by mass spectrometry in the culture filtrate of M. tuberculosis H37Rv but not the membrane protein fraction or whole cell lysates (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS483228483656-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0403c|mmpS1
MFGVAKRFWIPMVIVIVVAVAAVTVSRLHSVFGSHQHAPDTGNLDPIIAFYPKHVLYEVFGPPGTVASINYLDADAQPHEVVNAAVPWSFTIVTTLTAVVANVVARGDGASLGCRITVNEVIREERIVNAYHAHTSCLVKSA