Gene Rv0403c
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Unknown |
Product | Probable conserved membrane protein MmpS1 |
Comments | Rv0403c, (MTCY04D9.16c), len: 142 aa. Probable mmpS1, conserved membrane protein (see citation below), highly similar to other Mycobacterial proteins e.g. YV33_MYCLE|P54880 hypothetical 16.9 kDa protein from Mycobacterium leprae (154 aa), FASTA scores: opt: 458, E(): 1.6e-26, (46.9% identity in 143 aa overlap); YV33_MYCTU|Q11170 hypothetical 15.9 kDa protein from Mycobacterium tuberculosis (147 aa), FASTA scores: opt: 362, E(): 1.1e-19, (42.1% identity in 140 aa overlap); etc. Also similar to other MmpS proteins from Mycobacterium tuberculosis e.g. Rv0677c, Rv0451c, etc. Belongs to the MmpS family. Predicted to be an outer membrane protein (See Song et al., 2008). |
Functional category | Cell wall and cell processes |
Proteomics | Identified by mass spectrometry in the culture filtrate of M. tuberculosis H37Rv but not the membrane protein fraction or whole cell lysates (See de Souza et al., 2011). |
Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 483228 | 483656 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0403c|mmpS1 MFGVAKRFWIPMVIVIVVAVAAVTVSRLHSVFGSHQHAPDTGNLDPIIAFYPKHVLYEVFGPPGTVASINYLDADAQPHEVVNAAVPWSFTIVTTLTAVVANVVARGDGASLGCRITVNEVIREERIVNAYHAHTSCLVKSA
Bibliography
- Tekaia F et al. [1999]. Analysis of the proteome of Mycobacterium tuberculosis in silico. Secondary
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Song H, Sandie R, Wang Y, Andrade-Navarro MA and Niederweis M [2008]. Identification of outer membrane proteins of Mycobacterium tuberculosis. Localization
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant