Gene Rv0456A (mt2)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Possible toxin MazF1 |
| Comments | Rv0456A, len: 93 aa. Possible mazF1, toxin, part of toxin-antitoxin (TA) operon with Rv0456B (See Pandey and Gerdes, 2005; Zhu et al., 2006); N-terminus highly similar to N-terminal part of P71650|Rv2801c|MT2869|MTCY16B7.42 conserved hypothetical protein from Mycobacterium tuberculosis (118 aa), FASTA scores: opt: 303, E(): 1e-14, (60.44% identity in 91 aa overlap). Also some similarity in part with other hypothetical proteins e.g. Q9PHH8|XFA0027 Plasmid maintenance protein from Xylella fastidiosa (108 aa), FASTA scores: opt: 169, E(): 3.9e-05, (50.820% identity in 61 aa overlap). |
| Functional category | Virulence, detoxification, adaptation |
| Mutant | Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 547076 | 547357 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0456A|mazF1
MLRGEIWQVDLDPARGSAANMRRPAVIVSNDRANAAAIRLDRGVVPVVPVTSNTEKVPIPGVVAGSERWPGRRFEGAGPAGWIRRCATSPLPS
Bibliography
- Pandey DP et al. [2005]. Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Homology
- Zhu L et al. [2006]. Characterization of mRNA interferases from Mycobacterium tuberculosis. Product
- Gupta A [2009]. Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. Function
- Ramage HR, Connolly LE and Cox JS [2009]. Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. Function
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant