Gene Mb0465c
in Mycobacterium bovis AF2122/97
General annotation
Type | CDS |
Function | Unknown |
Product | possible toxin mazf1 |
Comments | Mb0465c, -, len: 93 aa. Equivalent to Rv0456A, len: 93 aa, from Mycobacterium tuberculosis strain H37Rv,(100.0% identity in 93 aa overlap). Conserved hypothetical protein; N-terminus highly similar to N-terminal part of P71650|Rv2801c|MT2869|MTCY16B7.42 CONSERVED HYPOTHETICAL PROTEIN from Mycobacterium tuberculosis (118 aa), FASTA scores: opt: 303, E(): 1e-14, (60.44% identity in 91 aa overlap). Also some similarity in part with other hypothetical proteins e.g. Q9PHH8|XFA0027 Plasmid maintenance protein from Xylella fastidiosa (108 aa),FASTA scores: opt: 169, E(): 3.9e-05, (50.820% identity in 61 aa overlap). |
Functional category | Virulence, detoxification, adaptation |
Mutant | Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 548095 | 548376 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium bovis AF2122-97|Mb0465c|mazf1 MLRGEIWQVDLDPARGSAANMRRPAVIVSNDRANAAAIRLDRGVVPVVPVTSNTEKVPIPGVVAGSERWPGRRFEGAGPAGWIRRCATSPLPS
Bibliography
No article yet recorded