Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductPossible toxin MazF1
CommentsRv0456A, len: 93 aa. Possible mazF1, toxin, part of toxin-antitoxin (TA) operon with Rv0456B (See Pandey and Gerdes, 2005; Zhu et al., 2006); N-terminus highly similar to N-terminal part of P71650|Rv2801c|MT2869|MTCY16B7.42 conserved hypothetical protein from Mycobacterium tuberculosis (118 aa), FASTA scores: opt: 303, E(): 1e-14, (60.44% identity in 91 aa overlap). Also some similarity in part with other hypothetical proteins e.g. Q9PHH8|XFA0027 Plasmid maintenance protein from Xylella fastidiosa (108 aa), FASTA scores: opt: 169, E(): 3.9e-05, (50.820% identity in 61 aa overlap).
Functional category-
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS547076547357-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0456A|mazF1
MLRGEIWQVDLDPARGSAANMRRPAVIVSNDRANAAAIRLDRGVVPVVPVTSNTEKVPIPGVVAGSERWPGRRFEGAGPAGWIRRCATSPLPS