Gene Rv0501 (galE1)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in galactose metabolism [catalytic activity: UDP-glucose = UDP-galactose]. |
| Product | Possible UDP-glucose 4-epimerase GalE2 (galactowaldenase) (UDP-galactose 4-epimerase) (uridine diphosphate galactose 4-epimerase) (uridine diphospho-galactose 4-epimerase) |
| Comments | Rv0501, (MTCY20G9.28), len: 376 aa. Possible galE2, UDP-glucose 4-epimerase, highly similar (except in N-terminus) to CAC31944.1|AL583925 possible glucose epimerase/dehydratase from Mycobacterium leprae (364 aa). N-terminus highly similar to S72923|B2168_C1_174|467075|AAA17259.1|U00018 hypothetical protein from Mycobacterium leprae (180 aa), FASTA scores: opt: 934, E(): 0, (89.6% identity in 164 aa overlap); and C-terminus highly similar to S72898|467050|AAA17234.1|U00018 hypothetical protein from Mycobacterium leprae (168 aa), FASTA scores: opt: 928, E(): 0, (82.7% identity in 168 aa overlap). Also highly similar to T36274|5123671|CAB45360.1|AL079345 probable epimerase from Streptomyces coelicolor (353 aa); and similar in part to other epimerases e.g. GALE_ECOLI|P09147 UDP-glucose 4-epimerase from Escherichia coli (338 aa), FASTA scores: opt: 241, E(): 6.7e-09, (28.2% identity in 294 aa overlap); etc. Belongs to the sugar epimerase family. Cofactor: NAD. Note that previously known as galE1. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in culture filtrates of M. tuberculosis H37Rv (See Malen et al., 2007). Identified in the cytosol and cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 591654 | 592784 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0501|galE2
VSSSNGRGGAGGVGGSSEHPQYPKVVLVTGACRFLGGYLTARLAQNPLINRVIAVDAIAPSKDMLRRMGRAEFVRADIRNPFIAKVIRNGEVDTVVHAAAASYAPRSGGSAALKELNVMGAMQLFAACQKAPSVRRVVLKSTSEVYGSSPHDPVMFTEDSSSRRPFSQGFPKDSLDIEGYVRALGRRRPDIAVTILRLANMIGPAMDTTLSRYLAGPLVPTIFGRDARLQLLHEQDALGALERAAMAGKAGTFNIGADGILMLSQAIRRAGRIPVPVPGFGVWALDSLRRANHYTELNREQFAYLSYGRVMDTTRMRVELGYQPKWTTVEAFDDYFRGRGLTPIIDPHRVRSWEGRAVGLAQRWGSRNPIPWSGLR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- MÃ¥len H et al. [2007]. Comprehensive analysis of exported proteins from Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant