Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductProbable conserved membrane protein MmpS2
CommentsRv0506, (MTCY20G9.33), len: 147 aa. Probable mmpS2, conserved membrane protein (see citation below), highly similar to other Mycobacterial proteins e.g. C-terminus of AAD44232.1|AF143772_38|AF143772|TmtpA from Mycobacterium avium (221 aa); P54880|MMS4_MYCLE|MMPS4 putative membrane protein from Mycobacterium leprae (154 aa), FASTA scores: opt: 392, E(): 1.3e-20, (43.7% identity in 151 aa overlap); and the putative membrane proteins from Mycobacterium tuberculosis MTV040_5, MTCY4D9_16, MTV037_15. Belongs to the MmpS family. Predicted to be an outer membrane protein (See Song et al., 2008).
Functional categoryCell wall and cell processes
ProteomicsPredicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted (See Malen et al., 2007). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate and membrane protein fraction of M. tuberculosis H37Rv but not whole cell lysates (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS596759597202+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0506|mmpS2
VRMISVSGAVKRMWLLLAIVVVAVVGGLGIYRLHSIFGVHEQPTVMVKPDFDVPLFNPKRVTYEVFGPAKTAKIAYLDPDARVHRLDSVSLPWSVTVETTLPAVSVNLMAQSNADVISCRIIVNGAVKDERSETSPRALTSCQVSSG