Gene Rv0527 (ccsA)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Possibly involved in cytochrome C synthesis. Might transfer reducing equivalents across the cytoplasmic membrane, promoting efficient disulfide bond isomerization of proteins localized on the outer surface of the membrane. |
| Product | Possible cytochrome C-type biogenesis protein CcdA |
| Comments | Rv0527, (MTCY25D10.06), len: 259 aa. Possible ccdA, cytochrome C-type biogenesis protein, integral membrane protein, equivalent to Q49810|B2168_C1_192|S72890 hypothetical protein from Mycobacterium leprae (262 aa), FASTA scores: opt: 1341, E(): 0, (79.0% identity in 262 aa overlap). Also highly similar to others e.g. CAC08380.1 (253 aa); CCDA_BACSU|P45706 cytochrome C-type biogenesis protein from Bacillus subtilis (235 aa), FASTA scores: opt: 307, E(): 7.4e-13, (30.4% identity in 237 aa overlap); etc. Seems to belong to the DSBD subfamily. Note that previously known as ccsA. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 617493 | 618272 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0527|ccdA
MTGFTEIAAVGPLLVAVGVCLLAGLVSFASPCVVPLVPGYLSYLAAVVGVDEQLPAGVVKPPVAARWRVAGSAALFVAGFTTVFVLGTVAVLGMTTTLITNQLLLQRVGGVLIVVMGLVFVGFIGALQRQARFTPRQLTSVAGAPVLGAVFALGWTPCLGPTLTGVITVASATEGASVARGIVLVIAYCLGLGIPFVLLAFGSAWAVAGLGWLRRHTRAIQIFGGALLIAVGAALVTGVWNDVVSWLRDAFVSDVRLPI
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
