Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionPossibly involved in cytochrome C synthesis. Might transfer reducing equivalents across the cytoplasmic membrane, promoting efficient disulfide bond isomerization of proteins localized on the outer surface of the membrane.
ProductPossible cytochrome C-type biogenesis protein CcdA
CommentsRv0527, (MTCY25D10.06), len: 259 aa. Possible ccdA, cytochrome C-type biogenesis protein, integral membrane protein, equivalent to Q49810|B2168_C1_192|S72890 hypothetical protein from Mycobacterium leprae (262 aa), FASTA scores: opt: 1341, E(): 0, (79.0% identity in 262 aa overlap). Also highly similar to others e.g. CAC08380.1 (253 aa); CCDA_BACSU|P45706 cytochrome C-type biogenesis protein from Bacillus subtilis (235 aa), FASTA scores: opt: 307, E(): 7.4e-13, (30.4% identity in 237 aa overlap); etc. Seems to belong to the DSBD subfamily. Note that previously known as ccsA.
Functional categoryIntermediary metabolism and respiration
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019).Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS617493618272+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0527|ccdA
MTGFTEIAAVGPLLVAVGVCLLAGLVSFASPCVVPLVPGYLSYLAAVVGVDEQLPAGVVKPPVAARWRVAGSAALFVAGFTTVFVLGTVAVLGMTTTLITNQLLLQRVGGVLIVVMGLVFVGFIGALQRQARFTPRQLTSVAGAPVLGAVFALGWTPCLGPTLTGVITVASATEGASVARGIVLVIAYCLGLGIPFVLLAFGSAWAVAGLGWLRRHTRAIQIFGGALLIAVGAALVTGVWNDVVSWLRDAFVSDVRLPI