Gene Rv0535
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Phosphorylates 5'-methylthioadenosin [catalytic activity: 5'-methylthioadenosine + phosphate = adenine + 5-methylthio-D-ribose 1-phosphate]. |
| Product | Probable 5'-methylthioadenosine phosphorylase Pnp (MTA phosphorylase) |
| Comments | Rv0535, (MTCY25D10.14c), len: 264 aa. Probable pnp, 5'-methylthioadenosine phosphorylase, highly similar to others e.g. CAB90972.1|AL355832 putative methylthioadenosine phosphorylase from Streptomyces coelicolor (280 aa); etc. Also similar to Rv3307|deoD probable purine nucleoside phosphorylase from Mycobacterium tuberculosis (268 aa). Belongs to the PNP/MTAP family 2 of phosphorylases. Gene name could be inappropriate. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 626457 | 627251 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0535|pnp
MHNNGRMLGVIGGSGFYTFFGSDTRTVNSDTPYGQPSAPITIGTIGVHDVAFLPRHGAHHQYSAHAVPYRANMWALRALGVRRVFGPCAVGSLDPELEPGAVVVPDQLVDRTSGRADTYFDFGGVHAAFADPYCPTLRAAVTGLPGVVDGGTMVVIQGPRFSTRAESQWFAAAGCNLVNMTGYPEAVLARELELCYAAIALVTDVDAGVAAGDGVKAADVFAAFGENIELLKRLVRAAIDRVADERTCTHCQHHAGVPLPFELP
Bibliography
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
