Gene Rv0541c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable conserved integral membrane protein |
| Comments | Rv0541c, (MTCY25D10.20c), len: 449 aa. Probable conserved integral membrane protein, highly similar (except first 40 residues) to CAB76994.1|AL159178 putative integral membrane protein from Streptomyces coelicolor (456 aa). Also some similarity to Q13724|GCS1_HUMAN mannosyl-oligosaccharide glucosidase (834 aa), FASTA scores: opt: 150, E(): 0.013, (27.1% identity in 339 aa overlap). Contains PS00041 Bacterial regulatory proteins, araC family signature. |
| Functional category | Cell wall and cell processes |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 633055 | 634404 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0541c|Rv0541c
VRIGRREGLAVAIGFVLVGAAFVLPRLNLGIKPRSDIGLERFATRAGAAPIFGYWDAHVGWGTAPAVLTAVAVVAWGPVVAHRLPWRVLTLSTWATAAAWAFSLAMIDGWQRGFAGRLTTRDEYLWQVPGIADIPATLRTFTSRILDFQPNSWVTHVSGHPPGALLTFVWLDRIGLRGGGWAGLVCLLVGSSAAAAVLIAVRVLASEQMARRTAPFVAVAPTAIWIAVSADGYFAGVAAWGIALLAVAVHGATRFPALVAAGAGLLLGWGVFLNYGLVLIVLPGMAVLAAADWRPVLRALGPAVLAALVVAVSFAVAGFSWFDGYTLVQQRYWQGIAKDRPFGYWSWANLACVVCAIGLGSVAGLSRVFDRAAISRRSGCHLLLLAVLAAIALADLSMLSKAETERIWLPFTIWLTAAPALLPPRSHRLWLAVNAAGALLLNSIIFTNW
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
