Gene Rv0544c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved transmembrane protein |
| Comments | Rv0544c, (MTCY25D10.23c), len: 92 aa. Possible conserved transmembrane protein, equivalent to NP_302470.1|NC_002677 possible membrane protein from Mycobacterium leprae (96 aa); and shows some similarity to MLU15187_33|Q50172|U296V from Mycobacterium leprae (36 aa), FASTA scores: opt: 151, E(): 2.1e-05, (71.4% identity in 35 aa overlap). Also some similarity with VATL_NEPNO|Q26250 vacuolar ATP synthase 16 kDa proteolipid from Nephrops norvegicus (159 aa), FASTA scores: opt: 80, E(): 11, (26.1% identity in 88 aa overlap). A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction; enriched in the membrane fraction and predicted N-terminal signal peptide is uncleaved (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 635935 | 636213 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0544c|Rv0544c
VSAWFNYTATLKILIFSLLAGALLPGLFAVGVRLQAAGDGADATARRRPLLVAVSWAIFALVLAVVIIGVLYIARDFIAHHTGWAFLGATPK
Bibliography
- Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST and Brosch R [2004]. Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex. Homology
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
