Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible conserved transmembrane protein
CommentsRv0544c, (MTCY25D10.23c), len: 92 aa. Possible conserved transmembrane protein, equivalent to NP_302470.1|NC_002677 possible membrane protein from Mycobacterium leprae (96 aa); and shows some similarity to MLU15187_33|Q50172|U296V from Mycobacterium leprae (36 aa), FASTA scores: opt: 151, E(): 2.1e-05, (71.4% identity in 35 aa overlap). Also some similarity with VATL_NEPNO|Q26250 vacuolar ATP synthase 16 kDa proteolipid from Nephrops norvegicus (159 aa), FASTA scores: opt: 80, E(): 11, (26.1% identity in 88 aa overlap). A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004).
Functional categoryCell wall and cell processes
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction; enriched in the membrane fraction and predicted N-terminal signal peptide is uncleaved (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS635935636213-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0544c|Rv0544c
VSAWFNYTATLKILIFSLLAGALLPGLFAVGVRLQAAGDGADATARRRPLLVAVSWAIFALVLAVVIIGVLYIARDFIAHHTGWAFLGATPK